荔园在线
荔园之美，在春之萌芽，在夏之绽放，在秋之收获，在冬之沉淀
[回到开始]
[上一篇][下一篇]
发信人: jjk (○), 信区: Linux
标 题: .vimrc (version 6.0)
发信站: 荔园晨风BBS站 (Sat Mar 23 11:00:41 2002), 转信
version 6.0
" See ":help version" to see why this command is in the first line.
"
" Let people know that they are using this setup file:
" echo "Welcome to Sven's setup file for all users!"
"
"
" ==================================================================
" File: $HOME/.vimrc.forall (sourced by ~USER/.vimrc)
" Last update: Mon Jan 21 18:43:50 MET 2002
" Purpose: Setup file for the editor Vim (Vi IMproved)
" Availability: This file is available as
" 27K <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc.gz>
" 76K <URL:http://www.math.fu-berlin.de/~guckes/setup/vimrc>
" <URL:http://www.vim.org/rc> (mirror)
" Size: This file is about 76K in size and has 2,000+ lines.
" Author: Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de)
" <URL:http://www.math.fu-berlin.de/~guckes/sven/>
" Related files:
" http://www.math.fu-berlin.de/~guckes/vim/src/emacs.vim
" http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim
" http://www.math.fu-berlin.de/~guckes/vim/src/html.vim
" http://www.math.fu-berlin.de/~guckes/vim/syntax/
" ===================================================================
" NOTE: If your read this then please send me an email!
" I welcome all feedback on this file - especially
" with new ideas such as abbreviations and mappings.
" Thanks! And enjoy Vim! :-)
" --Sven guckes@vim.org and guckes-vimrc@math.fu-berlin.de
" ===================================================================
" Webpages on Vim that you should know about:
" http://www.vim.org/ Vim Home Page (actually a mirror)
" http://www.vim.org/announce/ Vim Announcements
" http://www.vim.org/bina.html sites with vim binaries
" http://www.vim.org/bugs.html Some Vim Bugs
" http://www.vim.org/cvs.html CVS server
" http://www.vim.org/deve.html Current development issues
" http://www.vim.org/dist.html All mirrors in detail
" http://www.vim.org/faq/ Vim FAQ
" http://www.vim.org/hist.html History of ChangeLogs
" http://www.vim.org/html/ Vim Helptexts in HTML
" http://www.vim.org/howto/ Vim HowTo Texts
" http://www.vim.org/iccf/ Vim and the ICCF (see ":help iccf")
" http://www.vim.org/lang.html Language/SyntaxFile Summary
" http://www.vim.org/macs.html Vim on MacOS development
" http://www.vim.org/mail.html Mailing lists and all that
" http://www.vim.org/mirrors.html All mirror sites (ftp and www)
" http://www.vim.org/news.html NEWS about Vim and the pages
" http://www.vim.org/newsgroup.html Vim on comp.editors
" http://www.vim.org/orga.html vim.org background info
" http://www.vim.org/pics.html Pictures: buttons,icons,screenshots
" http://www.vim.org/press/ Articles on Vim in Magazines
" http://www.vim.org/quotes.html Quotes on Vim by users
" http://www.vim.org/sites.html Sites that use Vim officially
" http://www.vim.org/syntax/ Syntax files from current version
" http://www.vim.org/syntax.new/ New Syntax files (not yet in distrib)
" http://www.vim.org/user.html Vim Users and their pages on Vim
" http://www.vim.org/wish.html Wishlist for new features
" http://www.vim.org/why.html Why to use a vi clone (Vim!)
" http://www.vim.org/y2k.html Y2K issues (as if there are any..)
" ===================================================================
" Info on the latest versions of Vim are on the Vim Home Page:
" http://www.vim.org/
" Mind you, those pages are a *mirror* of the pages at
" http://www.math.fu-berlin.de/~guckes/vim/
" ===================================================================
" The latest versions of Vim are usually in my signature file:
" http://www.math.fu-berlin.de/~guckes/sig/SIGS Comments?
" ===================================================================
" Installation of this setup file:
" To use this setup file, copy it to
" this filename on these systems:
" ~/.vimrc Unix and OS/2
" s:.vimrc Amiga
" $VIM\_vimrc MS-DOS and Win32
" ===================================================================
" version check:
" The first line of this setup file contains the information
" "version xxx" which allows VIM to check whether the setup file
" fits the syntax that it understands.
" Versions of VIM other than of version 5 then will give a warning
" as they do not understand this setup file command - a feature:
" Give a warning so the user knows that there is something odd
" about the setup file.
" ===================================================================
" ===================================================================
" Structure of this file:
" Lines starting with an inverted comma (") are comments.
" Some mappings are commented out. Remove the comment to enable them.
"
" There are three kinds of things which are defined in this file:
" Mapping ("map"), settings ("set"), and abbreviations ("ab").
" Settings affect the behaviour of commands.
" Mappings maps a key sequence to a command.
" Abbreviations define words which are replaced
" right *after* they are typed in.
"
" ===================================================================
" Note on mappings - "angle notation" (see ":help <>"):
" VIM allows you to define mappings with special characters
" with a notation that uses non-special characters:
" The notation encloses decriptive words in angle brackets (<>).
" The characters you will most often are:
" <C-M> for control-m
" <C-V> for control-v which quotes the following character
" <ESC> for the escape character.
" All control characters have been replaced to use the angle notation
" so you should be able to read this file without problems.
" (Well, sometimes I leave some tabs [control-i] in the file. ;-)
" ===================================================================
" External programs:
" Some mappings make use of external programs.
" The following you should find/have on every UNIX system:
" cut, date; awk, egrep, grep, ispell, perl, sed.
" If you are using DOS then you should get these for you system!!
" See http://www.math.fu-berlin.de/~guckes/dos/ for some pointers!
" ===================================================================
" Online Help - jump to help positions with "\\":
" On some keyboards you will have some trouble with C-],
" the command to jump to the current help tag.
" The following mapping allows to use "\\", too:
map \\ <C-]>
" ===================================================================
" The command ":version" does not show the current value of
" VIMRUNTIME - dang! So I need a fast way to display that value:
map :V :echo $VIMRUNTIME<c-m>
" ===================================================================
" ===================================================================
" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML
" ===================================================================
" This has become quite big - so I moved it out to another file:
" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227]
" The "expand" is necessary to evaluate "~guckes".
let FILE=expand("~guckes/.P/vim/source/html.vim")
if filereadable(FILE)
exe "source " FILE
endif
" ===================================================================
"
" ===================================================================
" SETTING OPTIONS
" ===================================================================
" There are many options for Vim - over 200. Here is an overview:
" http://www.vim.org/options54.txt VIM-5.4 [990726] 218 options.
" http://www.vim.org/options57.txt VIM-5.7 [000624] 219 options.
" http://www.vim.org/options60ae.txt VIM-6.0ae [010504] 283 options.
" ===================================================================
"
" autoindent, paste, textwidth:
" I keep changing these values - just as the case may be.
" Now, if functions keys actually worked on all keyboards
" then I'd probably defines a toggle for each of them...
"
" autoindent: "off" as I usually do not write code.
set noautoindent
"
" autowrite: Automatically save modifications to files
" when you use critical (rxternal) commands.
set autowrite
"
" backup: backups are for wimps ;-)
set nobackup
"
" backspace: '2' allows backspacing" over
" indentation, end-of-line, and start-of-line.
" see also "help bs".
set backspace=2
"
" background: Are we using a "light" or "dark" background?
" set background=dark
"
" compatible: Let Vim behave like Vi? Hell, no!
set nocompatible
"
" comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:-
set comments=b:#,:%,fb:-,n:>,n:)
"
" cpoptions you should get to know - source of many FAQs! ;-)
" cpoptions: "compatible options" to match Vi behaviour
" set cpoptions="aABceFs" "default!
" FAQ: Do NOT include the flag '<' if you WANT angle notation!
"
" dictionary: english words first
set dictionary=/usr/dict/words,/local/lib/german.words
" Source for dictionaries (in unix-format):
" ftp://ftp.fu-berlin.de/misc/dictionaries/unix-format/
" However, these are quite old. Is there a better source?
"
" digraph: required for those umlauts
set digraph
"
" errorbells: damn this beep! ;-)
set noerrorbells
"
" esckeys: allow usage of cursor keys within insert mode
" You will find this useful when working, eg, on SunOS.
set esckeys
"
" In case you want this for SunOS only:
" if system('uname')=='SunOS'
" set ek
" endif
" expandtab: Expand Tabs? Rather not.
" See 'listchars' to make Tabs visible!
set noexpandtab
"
" formatoptions: Options for the "text format" command ("gq")
" I need all those options (but 'o')!
set formatoptions=cqrt
"
" helpheight: zero disables this.
set helpheight=0
"
" helpfile: path+filename of the main helpfile, ie "help.txt"
" set helpfile=c:\\vim-4.6\\docs\\help.txt
" set helpfile=c:/vim-4.6/docs/help.txt
" On Windows, I put the Vim helpfiles
" into the directory C:\VIM-version, eg C:\VIM-60ab
"
" Support users of old vim versions on the local net:
if version==507
set helpfile=/import/Mweb/guckes/vim/doc/help.txt
endif
"
" For use from a WindowsNT machine which mounts
" the user's home directory on drive 'Z':
" if has("dos16") || has("dos32") || has("gui_w32")
" set helpfile=Z:\share\vim\runtime\doc\help.txt
" endif
"
" hidden: Allow "hidden" buffers. A must-have!
set hidden
"
" highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws
set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws
"
" hlsearch : highlight search - show the current search pattern
" This is a nice feature sometimes - but it sure can get in the
" way sometimes when you edit.
set nohlsearch
"
" icon: ...
set noicon
"
" set iconstring file of icon (icons? on a terminal? pff!)
" set iconstring
"
" ignorecase: ignore the case in search patterns? NO!
set noignorecase
"
" insertmode:
" FAQ: Q: How can I quit insertmode when using this option?
" A: The option "insertmode" was not meant for "start Vim in
" insert mode" only; the idea is to *stay* in insert mode.
" Anyway, you can use the command |i_CTRL-O| to issue commands.
set noinsertmode
"
"
" iskeyword:
" iskeyword=@,48-57,_,192-255 (default)
" Add the dash ('-'), the dot ('.'), and the '@' as "letters" to "words".
" This makes it possible to expand email and html addresses,
" eg guckes-www@vim.org and http://www.vim.org/
set iskeyword=@,48-57,_,192-255,-,.,:,/,@-@
"
" joinspaces:
" insert two spaces after a period with every joining of lines.
" I like this as it makes reading texts easier (for me, at least).
set joinspaces
"
" keywordprg: Program to use for the "K" command.
" set keywordprg=man\ -s
"
" laststatus: show status line? Yes, always!
" laststatus: Even for only one buffer.
set laststatus=2
"
" [VIM5]lazyredraw: do not update screen while executing macros
set lazyredraw
"
" 'list' + 'listchars': Great new feature of vim-5.3!
" This tells Vim which characters to show for expanded TABs,
" trailing whitespace, and end-of-lines. VERY useful!!
" Standard settings:
" set list
" set listchars=tab:>-,trail:?eol:$
"
" However: The '$' at the end of lines is a bit too much, though.
" And I quite like the character that shows a dot in the middle:
" set listchars=tab:>?trail:?"
" Some people might prefer a double right angle (>>)
" to show the start of expanded tabs, though:
" set listchars=tab:环,trail:?"
" However, this all breaks up when viewing high-bit characters
" through some brain-dead telnet program (there are many).
" Sometimes a change of the font does the trick. Try it!
"
" magic: Use 'magic' patterns (extended regular expressions)
" in search patterns? Certainly! (I just *love* "\s\+"!)
set magic
"
" modeline: ...
" Allow the last line to be a modeline - useful when
" the last line in sig gives the preferred textwidth for replies.
set modeline
set modelines=1
"
" number: ...
set nonumber
"
" path: The list of directories to search when you specify
" a file with an edit command.
" Note: "~/.P" is a symlink to my dir with www pages
" "$VIM/syntax" is where the syntax files are.
" set path=.,,~/.P/vim,~/.P/vim/runtime/syntax,~/.P/vim/source,$VIM/syntax/
" set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn
"
" pastetoggle
if version>=508
set pastetoggle=<f11>
endif
"
" report: show a report when N lines were changed.
" report=0 thus means "show all changes"!
set report=0
"
" ruler: show cursor position? Yep!
set ruler
"
" runtimepath: list of dirs to search for runtime files
" runtimepath is for Vim-6 only!
" if version>=600
" set runtimepath=~/.vim,~/.vim/after
" set runtimepath+=~guckes/.vim
" set runtimepath+=~guckes/share/vim/runtime/
" set runtimepath+=~guckes/share/vim/
" set runtimepath+=~guckes/.P/Vim/syntax
" set runtimepath+=~guckes/share/vim/vim60ao/
" endif
" had to set this now that Vim won't use "helpfiles"
" to look for runtime files any more.
"
" Setting the "shell" is always tricky - especially when you are
" trying to use the same vimrc on different operatin systems.
" shell for DOS
" set shell=command.com
" shell for UNIX - math.fu-berlin.de BSD
" set shell=zsh
" shell for UNIX - inf.fu-berlin.de BSD&Solaris
" set shell=zsh
" shell for UNIX - zedat.fu-berlin.de BSD&Solaris
" set shell=/bin/tcsh
" Now that vim-5 has ":if" I am trying to automate the setting:
"
if has("dos16") || has("dos32")
let shell='command.com'
endif
" gui_w32: cmd.exe
"
" The zsh is now available at zedat.fu-berlin.de! :-)
" start the zsh as a login shell:
if has("unix")
let &shell="zsh\ -l"
endif
"
" shiftwidth: Number of spaces to use for each
" insertion of (auto)indent.
" set shiftwidth=8
set shiftwidth=2
"
" shortmess: Kind of messages to show. Abbreviate them all!
" New since vim-5.0v: flag 'I' to suppress "intro message".
set shortmess=at
"
" showcmd: Show current uncompleted command? Absolutely!
set showcmd
"
" showmatch: Show the matching bracket for the last ')'?
set showmatch
"
" showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS!
set showmode
"
" suffixes: Ignore filename with any of these suffixes
" when using the ":edit" command.
" Most of these are files created by LaTeX.
set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar
"
" startofline: no: do not jump to first character with page
" commands, ie keep the cursor in the current column.
set nostartofline
"
" splitbelow: Create new window below current one.
set splitbelow
"
" statusline: customize contents of the windows' status line.
" I prefer it this way:
" Show the current buffer number and filename with info on
" modification, read-only, and whether it is a help buffer
" (show only when applied).
" set statusline=[%n]\ %f\ %(\ %M%R%H)%)
"
" Move the rest to the right side, eg a copyright text:
" set statusline=[%n]\ %f\ %(\ %M%R%H)%)%=(c)\ Sven\ Guckes
"
" Show the value of the current character in ASCII and Hex:
" set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=ASCII=%b\ HEX=%B
"
" Show the current position with line+column+virtual_column:
" set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=Pos=<%l\,%c%V>\ %P
" Adding color through UserN groups:
" set statusline=%1*[%02n]%*\ %2*%F%*\ %(\ %M%R%H)%)%=%3*Pos=<%l,%c%V>%*
" User1: color for buffer number
" hi User1 ctermfg=red ctermbg=white
" User2: color for filename
" hi User2 ctermfg=green ctermbg=white
" hi User2 ctermfg=green ctermbg=black
" User3: color for position
" hi User3 ctermfg=blue ctermbg=white
"
" tabstop
set tabstop=8
"
" 990503: I have to set the "term" explicitly
" because the standard setups are broken.
" set term=builtin_pcansi
" set term=xterm
"
" Set the colors for vim on "xterm"
" if &term=="xterm"
" set t_Co=8
" set t_AB=%?%p1%{8}%<%t%p1%{40}%+%e%p1%{92}%+%;%dm
" set t_AF=%?%p1%{8}%<%t%p1%{30}%+%e%p1%{82}%+%;%dm
" endif
"
" textmode: no - I am using Vim on UNIX!
" set notextmode
"
" textwidth
set textwidth=79
"
" title:
set notitle
"
" ttyfast: are we using a fast terminal?
" seting depends on where I use Vim...
set nottyfast
"
" ttybuiltin:
set nottybuiltin
"
" ttyscroll: turn off scrolling -> faster!
set ttyscroll=0
"
" ttytype:
" set ttytype=rxvt
"
" viminfo: What info to store from an editing session
" in the viminfo file; can be used at next session.
set viminfo=%,'50,\"100,:100,n~/.viminfo
"
" visualbell:
set visualbell
"
" t_vb: terminal's visual bell - turned off to make Vim quiet!
" Please use this as to not annoy cow-orkers in the same room.
" Thankyou! :-)
set t_vb=
"
" whichwrap:
" Allow jump commands for left/right motion to wrap to previous/next
" line when cursor is on first/last character in the line:
set whichwrap=<,>,h,l,[,]
"
" wildchar the char used for "expansion" on the command line
" default value is "<C-E>" but I prefer the tab key:
set wildchar=<TAB>
"
" wrapmargin:
set wrapmargin=1
"
" writebackup:
set nowritebackup
"
" ===================================================================
" ABbreviations
" ===================================================================
" 980701: Moved the abbreviations *before* the mappings as
" some of the abbreviations get used with some mappings.
"
" Let's start of with some standard strings
" like the alphabet and the digits:
"
" Yalpha : The lower letter alphabet.
iab Yalpha abcdefghijklmnopqrstuvwxyz
"
" YALPHA : The upper letter alphabet.
iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ
"
" Ydigit: The ten digits.
iab Ydigit 1234567890
"
" Yruler: A "ruler" - nice for counting the length of words.
iab Yruler
1234567890123456789012345678901234567890123456789012345678901234567890123456789
012345678901234567890
"
" Abbreviations for some important numbers:
iab Npi 3.1415926535897932384626433832795028841972
iab Ne 2.7182818284590452353602874713526624977573
"
" Abbreviations for some classic long words:
" Donau... is the German word for the (read in reverse)
" "additional paragraph of the law regulating the pension of
" widows to captains of the ship company on (the river) Danube"
" (I am not making this up! ;-)
iab YDD
Donaudampfschifffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph
" New German spelling "schifffahrt", too! (Hi, Doram!)
"
" 010131
iab YTNGV Telekommunikationsnummerngebuehrenverordnung
"
" 010131
" iab YRRAG Rinderkennzeichnungs- und \
" Rindfleischetikettierungs黚erwachungsaufgaben黚ertragungsgesetz (RkRe蹵蹽
)
" Such words for law names can really make you MAD!! (moo!)
"
" Some more weird sentences in KrautLang
" using as many umlauts as possible:
" "J鰎g m鯿hte f黱f Fr黨st點ksbr鰐chen
" um 鋟遝rstes V鰈legef黨l zu sp黵en."
" "倪en L鰓en M鰓en, z鰃en M鰓en 黚er L鰓en r黚er."
" "倪e 謐o-J鰎g gro遝 B鋜enfe in 鋟遝rst ser Nu喏lk鋝eso遝
" mte er in ein 黚erm溥ig h溥liches G黮lefa?"
"
" and now a word with all three umlauts and the '?, too:
iab YHRA "Heiz鰈r點ksto遖bd鋗pfung"
" Yes, KrautLang *is* weird!
"
" But some languages are even weirder - Welsh, for example:
" YLL : The name of a town in Wales.
iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk
" http://194.159.85.168/ - I am not making this up! :-)
"
" and now something from down under:
" YTauma: The name of a hill in New Zealand.
iab YTauma
Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitan
atahu
"
" Longest Word in the second edition of the Oxford English Dictionary?
iab YNNMSVC pneumonoultramicroscopicsilicovolcanoconiosis
"
" Yupsidedown: This describes people from "down under" (Hi, Dean!).
iab Yupsidedown umop-ap!sdn
"
" Ysesqui: "Sesquipedalophobia" means "fear of big words." ;-)
iab Ysesqui sesquipedalophobia
"
" Yi18n: .123456789012345678. - yup, 18 characters betwwen 'i' and 'n'
iab Yi18n internationalization
"
" Ysuper: A nice long word from the musical "Mary Poppins".
iab Ysuper supercalifragilisticexpialidocious
"
"
" Phrases.
" Yanfs: Changing the Subject within a message. (Hi, Monty Python!)
iab Yanfs And now for something completely different...
"
" Yanti: The longest proper word in the English language?!
iab Yanti antidisestablishmentarianism
"
" Ybtdt: It's been dejavu all over again.
iab Ybtdt Been there, done that, got the tshirt.
"
" Yicty: Some people should really RTFM!
iab Yicty I could tell you - but then I'd have to kill you.
"
" Ypass: Standard answer to Usenet posts
" with the "Subject: HELP" (hehe)
iab Ypass "You are in a maze of twisty little passages, all alike."
"
" Ywttc: One more person using Vim.
iab Ywttc Welcome to the club!
"
" Ywyot: people who use the browser for email and news...
iab Ywyot when your only tool is a hammer - every problem looks like a nail.
"
"
"
"
" classic pangrams (which include every letter of the alphabet):
" German:
" kaufen sie jede woche vier gute bequeme pelze [missing: 'xy' :-/]
" sylvia wagt quick den jux bei pforzheim
" bayerische jagdwitze von maxl querkopf
" zwei boxkaempfer jagen eva quer durch sylt
" falsches 黚en von xylophonmusik qu鋖t jeden gr鲞eren zwerg.
" Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch!
" English:
" the quick brown fox jumps over the lazy dog
" The five boxing wizards jump quickly
" French:
" voyez le brick geant que j'examine pres du wharf.
" Polish:
" Pchn辨 w t?丑d?je縜 lub o秏 skrzy?fig.
" Ko?i 矿硍 grali w ko禼i z pi阫n?鎚?u 紃骴砤.
" T阦i ko?i ma硑 矿硍 秔iewali z pi阫n?鎚?u 紃骴砤 縴cia.
"
" And a sentence to break some quoing levels:
" "This man's house (which 's yellow) burned down."
"
" And now for something completely different:
" I couldn't bear to bear bears over the border.
"
" Inserting an ellipsis to indicate deleted text
iab Yell [...]
vmap ,ell c[...]<ESC>
"
" some words I type often enough:
iab eig eigentlich
iab merkw merkwuerdig
"
" typing smileys slows me down..
iab BAH :-(
iab SMILE :-)
iab WINK ;-)
"
" Correcting those typos. [I almost never get these right. :-(]
" See also: http://www.igd.fhg.de/~zach/programs/acl/
iab alos also
iab aslo also
iab becuase because
iab bianry binary
iab bianries binaries
iab charcter character
iab charcters characters
iab exmaple example
iab exmaples examples
iab shoudl should
iab seperate separate
iab teh the
iab tpyo typo
" Some frequent typos in German:
iab bracuht braucht
iab doer oder
iab nciht nicht
iab Dreckfuhler Druckfehler
"
" Sorry, Laurent!
iab Laurant Laurent
"
" See http://www.math.fu-berlin.de/~guckes/sig/:
iab YDDS dash-dash-space
"
" For reports and texts on my studies:
" iab YKT Komplexitaetstheorie
" iab YRA Rechnerarchitektur
" iab YPM Pattern Matching
" see http://elib.zib.de/ICM98 :
" iab YICM International Congress of Mathematicians
"
" Some sentences that I really use often in emails about Vim:
iab YAW You are welcome!
iab YEV Enjoy Vim! :-)
"
" Often used filenames - only needed these on the command line:
" see also: http://www.math.fu-berlin.de/~guckes/setup/
"
" cab ELMALIAS ~/.elm/aliases.text
" cab Erc ~/.elm/elmrc
" cab Mrc ~/.muttrc
" cab Src ~/.slrnrc
" cab Zrc ~/.zsh/.zshrc
"
" Email Adresses:
" I usually use these when adding addresses to the header
" of emails (mutt) and posts (slrn).
"
" Author of the Good NetKeeping Seal of Approval:
ab Agnksa js@xs4all.nl (Jeroen Scheerder)
"
" Original author of Mutt:
" ab Amutt me@cs.hmc.edu (Michael Elkins)
" Maintainer of Mutt:
ab Amutt roessler@guug.de (Thomas Roessler)
"
" Author of Slrn:
ab Aslrn davis@space.mit.edu (John E. Davis)
" Maintainer of Slrn:
ab Mslrn tststs@gmx.de (Thomas Schultz)
"
" Author of Vim - vim specific address:
ab Avim bram@vim.org (Bram Moolenaar)
" Author of Vim - private address:
ab Abram Bram@Moolenaar.net (Bram Moolenaar)
"
" Author, contributor, maintainer of
" add atac autoconf bcpp ded dialog diffstat flist
" lynx ncurses tin vile vttest xterm - and more!
ab Avile dickey@his.com (Thomas E. Dickey)
"
" Former Maintainer of the Vim FAQ:
" ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval)
ab Avimfaq guckes@vim.org (Sven Guckes)
"
" Mailing Lists (MLs)
"
" The Vim mailing lists: See http://www.vim.org/mail.html for more info!
" ab MLvim vim@vim.org (VIM Help List)
" ab MLvimdev vim-dev@vim.org (VIM General Development List)
" ab MLvimmac vim-mac@vim.org (VIM on MacOS Development List)
" ab MLvimmb vim-multibyte@vim.org (VIM MultiByte Development List)
" ab MLvimfr vim-fr@egroups.com (VIM Help List for French Users)
"
" More mailing lists:
" ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List)
" ab MLmuttuser mutt-users@mutt.org (Mutt Users List)
" ab MLzsh zsh-users@sunsite.auc.dk (ZShell Users List)
"
"
" News: newsgroup names
"
" Newsgroup about "warloding" of signatures - see
" also http://www.math.fu-berlin.de/~guckes/afw/
iab Nafw alt.fan.warlord
iab Nahbou alt.humor.best-of-usenet
iab Nzedat bln.announce.fub.zedat.d
iab Ncsd bln.announce.fub.cs.d
iab Nce comp.editors
iab NcE de.comp.editoren
" Newsgroup about "lynx":
iab Nhtml comp.infosystems.www.authoring.html
" Newsgroup about "elm": Elm is dead - long live Mutt!
iab Nelm comp.mail.elm
" Newsgroup about "pine": When will they release pine-4?
" iab Ncmp comp.mail.pine
iab Npine comp.mail.pine
" iab Ncsmd comp.sys.mac.digest
" Newsgroup about "mobil phone systems":
iab Ndcm de.comm.mobil
iab Nmobil de.comm.mobil
" Newsgroup about "web browsers":
iab Nlynx comp.infosystems.www.browsers.misc
iab Nnetscape comp.infosystems.www.browsers.misc
" Newsgroup about "mutt" [since 980401]: The coolest mail user agent
iab Nmutt comp.mail.mutt
" Newsgroup about "nn": Once was the best newsreader. Still good.
iab Nnn news.software.nn
" Newsgroup for "newbies".
" All you ever wanted to know - but were afraid to ask. ;-)
iab Newbie news.newusers.questions
" Newsgroup about "newsreader *agents*" (netscape and slrn):
iab Nnsr news.software.readers
"
" Usenet header lines (used when composing a post):
"
iab UFT Followup-To:
iab UMCT Mail-Copies-To: MYADDR
iab UNG Newsgroups:
iab URT Reply-To: MYADDR
iab UFUB Organization: Freie Universitaet Berlin
"
" Current version numbers of my favourite programs:
" http://www.math.fu-berlin.de/~guckes/faq/program.versions.html
" And some abbreviations to type them in mail&news:
" [Last update: 001220]
iab Velmold ELM2.4PL25 [951204]
iab Velm ELM2.5.3 [000113]
iab Velmme ELMME+86 [001219]
iab Vless less-358 [000709]
iab Vlynx lynx-2.8.4dev14 [001103]
iab Vmutt mutt-1.2.5 [000729]
iab Vslrn slrn-0.9.6.3 [000918]
iab Vvim vim-5.7 [000624]
iab Vvimdev vim-6.0w [010226]
"
" My phone number (main phone number and fax):
iab Yphone TEL (+49 30) 8838884<CR>FAX (+49 30) 88629362
" My cellphone number:
iab Ycell TEL (+49 179) 3966141
" If you like then send me a short message to my cellphone via this page:
iab FreeSMS http://www.free-sms.com/sendsms/index.php3
" My snailmail address. Postcards, anyone?
iab Ysnail Sven Guckes<C-M>Pariser Str. 52<C-M>D-10719 Berlin
" My ICQ number. Chat, anyone?
iab YICQ ICQ:38801898
"
" My addresses (Email and WWW)
" makes it easy to type them without typos ;-)
ab Amaili guckes@inf.fu-berlin.de
ab Amailm guckes@math.fu-berlin.de
ab Amailv guckes@vim.org
ab Amailz guckes@zedat.fu-berlin.de
" ab Apriv sven@guckes.net
ab MYADDR guckes@math.fu-berlin.de
ab MYNAME Sven Guckes
ab MYDOMAIN math.fu-berlin.de
" ab MYDOMAIN guckes.net
"
" Setting the reply address when replying as the guy from SKB:
" ab ASKB Sprachboerse <sprachboerse@tu-berlin.de>
" See also: http://www.math.fu-berlin.de/~guckes/skb/
"
" My Home Pages at the departments at the FUB and elsewhere...
"
ab WWWb http://www.belug.org/~guckes/
ab WWWm http://www.math.fu-berlin.de/~guckes/
ab WWWi http://www.inf.fu-berlin.de/~guckes/
ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/
"
" WWW Pages base URLs
"
ab HPA http://www.math.fu-berlin.de/~guckes/afw/
ab HPa http://www.math.fu-berlin.de/~guckes/ascii/
ab HPc http://www.math.fu-berlin.de/~guckes/calvin/
ab HPD http://www.math.fu-berlin.de/~guckes/dos/
ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html
ab HPE http://www.math.fu-berlin.de/~guckes/elm/
ab HPI http://www.math.fu-berlin.de/~guckes/irc/
ab HPi http://www.math.fu-berlin.de/~guckes/ispell/
ab HPL http://www.math.fu-berlin.de/~guckes/lynx/
ab HPl http://www.math.fu-berlin.de/~guckes/less/
ab HPm http://www.math.fu-berlin.de/~guckes/mail/
ab HPme http://www.math.fu-berlin.de/~guckes/mail/edit.html
ab HPM http://www.math.fu-berlin.de/~guckes/mutt/
ab HPN http://www.math.fu-berlin.de/~guckes/nn/
ab HPP http://www.math.fu-berlin.de/~guckes/pine/
ab HPO http://www.math.fu-berlin.de/~guckes/outlookexpress/
ab HPp http://www.math.fu-berlin.de/~guckes/procmail/
ab HPR http://www.math.fu-berlin.de/~guckes/rot13/
ab HPr http://www.math.fu-berlin.de/~guckes/rtfm/
ab HPs http://www.math.fu-berlin.de/~guckes/screen/
ab HPS http://slrn.sourceforge.net/
ab HPS1 http://www.math.fu-berlin.de/~guckes/slrn/
ab HPS2 http://www.slrn.org/
" HPov - the "original" URL of the Vi Editor Page!
ab HPov http://www.math.fu-berlin.de/~guckes/vi/
ab HPv http://vi-editor.org
ab HPw http://www.math.fu-berlin.de/~guckes/windows/
ab HPV http://www.vim.org/
" HPOV - the "original" URL of the Vim Home Page!
ab HPOV http://www.math.fu-berlin.de/~guckes/vim/
ab HPx http://www.math.fu-berlin.de/~guckes/xmas/
ab HPz http://www.math.fu-berlin.de/~guckes/zsh/
"
" Other important WWW addresses
"
ab URLaltavista http://www.altavista.de/textonly.html
ab URLftpsearch http://ftpsearch.lycos.com/?form=advanced
ab URLrpmfind http://rpmfind.net
ab URLslashdot http://slashdot.org
ab URLfreshmeat http://freshmeat.net
"
" Pictures:
ab URLbambi http://www.math.fu-berlin.de/~guckes/pics/calvin/bambi.gif
ab URLsecret http://www.math.fu-berlin.de/~guckes/pics/calvin/secret.gif
ab URLwhome http://www.math.fu-berlin.de/~guckes/pics/calvin/who_me.gif
ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/spam/stop.jpg
ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/
"
" The nearest vim site for me:
ab FTPG ftp://ftp.math.fu-berlin.de/pub/usr/guckes/
ab FTPFUB ftp://ftp.fu-berlin.de/
" ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/
ab FTPVIM ftp://vim.ftp.fu-berlin.de/
ab URLVINE http://www.mossbayeng.com/~ron/vim/vine.html
" But you should look at http://www.vim.org/dist.html instead!
"
" ===================================================================
" Abbreviations - Header Lines for Email and News
" ===================================================================
" Define regexpr for headers to use with mappings
" as it makes reading the mappings much easier:
" cab HADDR From\\|Cc\\|To
cab HEMAIL
^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\)
cab HNEWS
^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\)
"
" ===================================================================
" Abbreviations - General Editing - Inserting Dates and Times
" ===================================================================
"
" First, some command to add date stamps (with and without time).
" I use these manually after a substantial change to a webpage.
" [These abbreviations are used with the mapping for ",L".]
"
iab Ydate <C-R>=strftime("%y%m%d")<CR>
" Example: 971027
"
iab Ytime <C-R>=strftime("%H:%M")<CR>
" Example: 14:28
"
" man strftime: %T time as %H:%M:%S
" iab YDT <C-R>=strftime("%y%m%d %T")<CR>
" Example: 971027 12:00:00
"
" man strftime: %X locale's appropriate time representation
iab YDT <C-R>=strftime("%y%m%d %X")<CR>
" Example: 000320 20:20:20
"
iab YDATE <C-R>=strftime("%a %b %d %T %Z %Y")<CR>
" Example: Tue Dec 16 12:07:00 CET 1997
"
" On Windows the functions "strftime" seems to have a different
" format. Therefore the following may be necessary: [980730]
" if !has("unix")
" iab YDATE <C-R>=strftime("%c %a")<CR>
" else
" iab YDATE <C-R>=strftime("%D %T %a")<CR>
" endif
"
" 000306: These two lines at the start of a Perl script
" will start the first Perl in your Shell's $PATH.
iab Yperlhead eval 'exec perl -w -S $0 ${1+"$@"}'<c-m>if 0;<c-m>
"
"
" ===================================================================
" MAPpings
" ===================================================================
" Caveat: Mapping must be "prefix free", ie no mapping must be the
" prefix of any other mapping. Example: "map ,abc foo" and
" "map ,abcd bar" will give you the error message "Ambigous mapping".
"
" The backslash ('\') is the only(?) unmapped key, so this is the best
" key to start mappings with as this does not take away a command key.
" However, the backslash is never in the same position with keyboards.
" Eg on German keyboards it is AltGr-sz - don't ask.
" Anyway, I have decided to start mappings with the comma as this
" character is always on the same position on almost all keyboards
" and I hardly have a need for that command.
"
" The following maps get rid of some basic problems:
"
" When the backspace key sends a "delete" character
" then you simply map the "delete" to a "backspace" (CTRL-H):
" map <Del> <C-H>
"
" With Vim-4 the format command was just 'Q' and
" I am too used to it. So I need this back!
nnoremap Q gq
vnoremap Q gq
"
" 980527 I often reformat a paragraph to fit some textwidth -
" and I use the following mapping to adjust it to the
" current position of the cursor:
map #tw :set textwidth=<C-R>=col(".")<C-M>
"
" 981210 Whenever I paste some text into VIM I have to
" toggle from "nopaste" to "paste" and back again:
" map <f4> :set paste!<C-M>:set paste?<C-M>
" map <esc>[14~ :set paste!<C-M>:set paste?<C-M>
" --> new option for this: 'pastetoggle'
"
" "tal" is the "trailer alignment" filter program
" Hopefully it will ship with Vim one day.
" vmap #t !tal<CR>
" vmap #t !tal -p 0<CR>
"
" Disable the command 'K' (keyword lookup) by mapping it
" to an "empty command". (thanks, Lawrence! :-):
" map K :<CR>
" map K :<BS>
" More elegant: (Hi Aziz! :-)
map K <NUL>
"
" Disable the suspend for ^Z.
" I use Vim under "screen" where a suspend would lose the
" connection to the " terminal - which is what I want to avoid.
map <C-Z> :shell
"
" Make CTRL-^ rebound to the *column* in the previous file
noremap <C-^> <C-^>`"
"
" Make "gf" rebound to last cursor position (line *and* column)
noremap gf gf`"
"
" When I let Vim write the current buffer I frequently mistype the
" command ":w" as ":W" - so I have to remap it to correct this typo:
nmap :W :w
" TODO: Use the following (after some testing):
" command -nargs=? -bang W w<bang> <args>
"
" Are you used to the Unix commands "alias" and "which"?
" I sometimes use these to look up my abbreviations and mappings.
" So I need them available on the command line:
map :alias map
map :which map
"
" The command {number}CTRL-G show the current nuffer number, too.
" This is yet another feature that vi does not have.
" As I always want to see the buffer number I map it to CTRL-G.
" Pleae note that here we need to prevent a loop in the mapping by
" using the comamnd "noremap"!
noremap <C-G> 2<C-G>
"
" 001010 Do the Color Test!
map ,CT :sp $VIMRUNTIME/syntax/colortest.vim<cr>:so %<cr>
" 000329 View the file which defines the "filetypes":
map ,F :view $VIMRUNTIME/filetype.vim
"
" 980311 Sourcing syntax files::
map ,SO :source $VIMRUNTIME/syntax/
"
" 980706,000310 View a syntax file:
map ,V :view $VIMRUNTIME/syntax/
"
" 000801 Hilite Test - show all current highlight groups
" see ":help hitest.vim"
map ,HI :so $VIMRUNTIME/syntax/hitest.vim
"
" 990614 Quick insertion of an empty line:
" nmap <CR> o<ESC>
" I find this convenient - but as I am also used to proceed to
" next line by pressing CR this often gives me new empty lines
" when I really do not need them. :-(
"
" ===================================================================
" Customizing the command line
" ===================================================================
" Valid names for keys are: <Up> <Down> <Left> <Right> <Home> <End>
" <S-Left> <S-Right> <S-Up> <PageUp> <S-Down> <PageDown> <LeftMouse>
"
" Many shells allow editing in "Emacs Style".
" Although I love Vi, I am quite used to this kind of editing now.
" So here it is - command line editing commands in emacs style:
cnoremap <C-A> <Home>
cnoremap <C-B> <Left>
" cnoremap <C-B> <Del>
cnoremap <C-E> <End>
cnoremap <C-F> <Right>
cnoremap <C-N> <End>
cnoremap <C-P> <Up>
cnoremap <ESC>b <S-Left>
cnoremap <ESC><C-B> <S-Left>
cnoremap <ESC>f <S-Right>
cnoremap <ESC><C-F> <S-Right>
cnoremap <ESC><C-H> <C-W>
" Note: More info about this is in the helptexts: :help emacs-keys
"
" Additional codes for that "English" keyboard at the Xterminal
cnoremap <ESC>[D <Left>
cnoremap <ESC>[C <Right>
"
" ===================================================================
" VIM - Editing and updating the vimrc:
" As I often make changes to this file I use these commands
" to start editing it and also update it:
if has("unix")
let vimrc='~/.vimrc'
else
" ie: if has("dos16") || has("dos32") || has("win32")
let vimrc='$VIM\_vimrc'
endif
nn ,u :source <C-R>=vimrc<CR><CR>
nn ,v :edit <C-R>=vimrc<CR><CR>
" ,v = vimrc editing (edit this file)
" map ,v :e ~/.vimrc<CR>
" ,u = "update" by reading this file
" map ,u :source ~/.vimrc<CR>
" ===================================================================
"
" General Editing
"
" Define "del" char to be the same backspace (saves a LOT of trouble!)
" As the angle notation cannot be use with the LeftHandSide
" with mappings you must type this in *literally*!
" map <C-V>127 <C-H>
"cmap <C-V>127 <C-H>
" the same for Linux Debian which uses
imap <Esc>[3~ <C-H>
"
" ;rcm = remove "control-m"s - for those mails sent from DOS:
cmap ;rcm %s/<C-M>//g
"
" Make whitespace visible:
" Sws = show whitespace
nmap ,Sws :%s/ /_/g<C-M>
vmap ,Sws :%s/ /_/g<C-M>
"
" Sometimes you just want to *see* that trailing whitespace:
" Stws = show trailing whitespace
nmap ,Stws :%s/ *$/_/g<C-M>
vmap ,Stws :%s/ *$/_/g<C-M>
"
" General Editing - Turning umlauts into ascii (for German keyboards)
"
" imap ?ae
" imap ?oe
" imap ?ue
" imap ?ss
"
" Ä -> ? :%s/\Ä/?gc -> D
" Ö -> ? :%s/\Ö/?gc -> V
" Ü -> ? :%s/\Ü/?gc -> \
" ä -> ? :%s/\ä/?gc -> d
" ö -> ? :%s/\ö/?gc -> v
" ü -> ? :%s/\ü/?gc -> |
"
" ===================================================================
" Inserting Dates and Times / Updating Date+Time Stamps
" ===================================================================
" ,L = "Last update" - replace old time stamp with a new one
" preserving whitespace and using internal "strftime" command:
" requires the abbreviation "YDATE"
map ,L 1G/Last update:\s*/e+1<CR>CYDATE<ESC>
map ,,L 1G/Last change:\s*/e+1<CR>CYDATE<ESC>
" Example:
" before: "Last update: Thu Apr 6 12:07:00 CET 1967"
" after: "Last update: Tue Dec 16 12:07:00 CET 1997"
"
" I used to read in the output from the external command "date"
" but this is a little slow and does not work on all systems:
" map ,L 1G/Last update: */e+1<CR>D:r!date<CR>kJ
"
" ===================================================================
" General Editing - link to program "screen"
" ===================================================================
"
" ,Et = edit temporary file of "screen" program
map ,Et :e /tmp/screen-exchange
" as a user of Unix systems you *must* have this program!
" see also: http://www.math.fu-berlin.de/~guckes/screen/
"
" Email/News - Editing replies/followups
"
" Part 1 - prepare for editing
"
" Part 2 - getting rid of empty (quoted) lines and space runs.
"
" Delete trailing whitespace:
nmap <f9> :%s/\s\+$//
vmap <f9> :s/\s\+$//
"
" ,cel = "clear empty lines"
" - delete the *contents* of all lines which contain only whitespace.
" note: this does not delete lines!
" map ,cel :g/^[<C-I> ]*$/d
map ,cel :%s/^\s\+$//
"
" ,del = "delete 'empty' lines"
" - delete all lines which contain only whitespace
" note: this does *not* delete empty lines!
map ,del :g/^\s\+$/d
"
" ,cqel = "clear quoted empty lines"
" Clears (makes empty) all lines which start with '>'
" and any amount of following spaces.
" nmap ,cqel :%s/^[> ]*$//
" vmap ,cqel :s/^[> ]*$//
" nmap ,cqel :%s/^[><C-I> ]\+$//
" vmap ,cqel :s/^[><C-I> ]\+$//
nmap ,cqel :%s/^[>]\+$//
vmap ,cqel :s/^[><C-I> ]\+$//
" NOTE: If the meta sequence "\s"
" The following does not work because "\s" is not a character
" and thus cannot be part of a "character set".
" map ,cqel :%s/^[>\s]\+$//
"
" Some people have strange habits within their writing.
" But if you cannot educate them - rewrite their text! ;-)
"
" Jason "triple-dots" King elephant@onaustralia.com.au
" does uses ".." or "..." rather than the usual punctuation
" (comma, semicolon, colon, full stop). So...
"
" Turning dot runs with following spaces into an end-of-sentence,
" ie dot-space-space:
vmap ,dot :s/\.\+ \+/. /g
"
" Gary Kline (kline@tera.tera.com) indents his
" own text in replies with TAB or spaces.
" Here's how to get rid of these indentation:
vmap ,gary :s/^>[ <C-I>]\+\([^>]\)/> \1/
"
" ,ksr = "kill space runs"
" substitutes runs of two or more space to a single space:
" nmap ,ksr :%s/ */ /g
" vmap ,ksr :s/ */ /g
nmap ,ksr :%s/ \+/ /g
vmap ,ksr :s/ \+/ /g
" Why can't the removal of space runs be
" an option of "text formatting"? *hrmpf*
"
" ,Sel = "squeeze empty lines"
" Convert blocks of empty lines (not even whitespace included)
" into *one* empty line (within current visual):
map ,Sel :g/^$/,/./-j
"
" ,Sbl = "squeeze blank lines"
" Convert all blocks of blank lines (containing whitespace only)
" into *one* empty line (within current visual):
" map ,Sbl :g/^\s*$/,/[^ <C-I>]/-j
" map ,Sbl :g/^\s*$/,/[^ \t]/-j
map ,Sbl :g/^\s*$/,/\S/-j
"
" ===================================================================
" AUTOCOMMANDS:
" Editing of email replies and Usenet followups - using autocommands
" ===================================================================
"
" First step: Remove ALL auto-commands. This avoids having the
" autocommands twice when the vimrc file is sourced again.
autocmd!
"
" Add/change some filename patterns to filetypes:
" let myfiletypefile = "~/.vim.myfiletypes"
"
" And this goes into "~/.vim.myfiletypes":
" augroup filetype
" au BufRead,BufNewFile postpone/* set filetype=mail
" augroup END
"
" Apply my syntax file on files with extension "sdg":
au BufNewFile,BufRead *.sdg set ft=sveng
"
" Apply the muttrc coloring to my mutt setup files:
au BufNewFile,BufRead .mutt.* set ft=muttrc
"
" SLRN: Apply mail.vim to postponed messages:
au BufNewFile,BufRead */postpone/* set ft=mail
"
" Set some options for "messages" (FileType "mail"):
" au FileType mail set autoindent expandtab tabstop=4 textwidth=70
" the following uses ethe short option names:
if version>=600
au FileType mail set ai et ts=4 tw=70
endif
"
" Some more autocommand examples which set the values for
" "autoindent", "expandtab", "shiftwidth", "tabstop", and "textwidth":
" using the "FileType" event:
" au FileType c set ai et sw=4 ts=4
" au FileType perl set ai et sw=4 ts=4
" au FileType html set ai sw=2 ts=2
" au FileType java set ai sw=4 ts=4
" au BufEnter */drafts/* set tw=72
"
" Try to use the mapping ",D" when doing a followup.
" autocmd BufNewFile ~/.followup ,D|
"
" Setting "X-Editor":
" Let Vim identify itself in the message header
" when editing emails with Mutt and Slrn:
" au FileType mail let @"="X-Editor: Vim-".version." http://www.vim.org/\n"|exe
'norm 1G}""P'
"
" Generation of a "Message-ID" header line (according to ISO8061):
"
" Let Vim add a Message-ID to your posts with Slrn:
"
" Add a Message-ID to posts with Slrn:
" au BufNewFile,BufRead ~/.article let @"="Message-ID: <slrn.".
system("uname").".".strftime("%y%m%d%H%M")."\n"|exe 'norm 1G}""P'
" Problem: The uname adds a CTRL-J at the end of the output. :-(
"
" Add a Message-ID to posts with Slrn (mimimal format):
" au BufNewFile,BufRead ~/.article,~/.followup let @"="Message-ID: <".
strftime("%Y%m%dT%H%M%S")."@guckes.net>\n"|exe 'norm 1G}""P'
" Example: Message-ID: <20000406T120700@guckes.net>
" Problem: The date and time are hard to read.
" It's easier with a few delimiters:
"
" Add a Message-ID to posts with Slrn (with delimiters):
" au BufNewFile,BufRead ~/.article,~/.followup let @"="Message-ID: <".
strftime("%Y-%m-%dT%H-%M-%S")."@guckes.net>\n"|exe 'norm 1G}""P'
" Example: Message-ID: <2000-04-06T12-07-00@guckes.net>
"
" news.fu-berlin.de rejects Message-IDs with colons in it:
" Example: Message-ID: <2000-04-06T12:07:00@guckes.net>
"
"
" Part 3 - Change Quoting Level
"
" ,dp = de-quote current inner paragraph
" map ,dp {jma}kmb:'a,'bs/^> //<CR>
map ,dp vip:s/^> //<CR>
vmap ,dp :s/^> //<CR>
"
" ,qp = quote current paragraph
" jump to first inner line, mark with 'a';
" jump to last inner line, mark with 'b';
" then do the quoting as a substitution
" on the line range "'a,'b":
" map ,qp {jma}kmb:'a,'bs/^/> /<CR>
" vim-5 now has selection of "inner" and "all"
" of current text object - mapping commented!
"
" ,qp = quote current paragraph (old version)
" jump to first inner line, Visual,
" jump to last inner line,
" then do the quoting as a substitution:
" map ,qp {jV}k:s/^/> /<CR>
"
" ,qp = quote current inner paragraph (works since vim-5.0q)
" select inner paragraph
" then do the quoting as a substitution:
map ,qp vip:s/^/> /<CR>
"
" ,qp = quote current paragraph
" just do the quoting as a substitution:
vmap ,qp :s/^/> /<CR>
"
" ## = comment current inner paragraph with '#':
nmap ## vip:s/^/#<space>/<CR>
" ## = comment current text selection with '#':
vmap ## :s/^/#<space>/<CR>
"
" 001006: Commenting selected lines in C style:
" vmap ## :s#^#// #<cr>'<O/*<esc>'>o*/<esc>gv
"
" Example of result:
" /*
" // foo
" // bar
" /*
"
" Changing quote style to *the* true quote prefix string "> ":
"
" Fix Supercite aka PowerQuote (Hi, Andi! :-):
" before ,kpq: > Sven> text
" after ,kpq: > > text
" ,kpq kill power quote
vmap ,kpq :s/^> *[a-zA-Z]*>/> >/<C-M>
"
" Fix various other quote characters:
" ,fq "fix quoting"
vmap ,fq :s/^> \([-":}\|][ <C-I>]\)/> > /
"
" Fix the quoting of "Microsoft Internet E-Mail":
" The guilty mailer identifies like this:
" X-Mailer: Microsoft Internet E-Mail/MAPI - 8.0.0.4211
"
" And this is how it quotes - with a pseudo header:
"
" -----Ursprungliche Nachricht-----
" Von: NAME [SMTP:ADDRESS]
" Gesendet am: Donnerstag, 6. April 2000 12:07
" An: NAME
" Cc: NAME
" Betreff: foobar
"
" And here's how I "fix" this quoting:
" (it makes use of the mappings ",dp" and ",qp"):
map #fix1 /^> -----.*-----$<cr>O<esc>j,dp<c-o>dapVG,qp
"
" 010613
" X-Mailer: Internet Mail Service (5.5.2650.21)
" Oh, boy, I *hate* this mailer. This
" one certainly sends *crappy* mails.
" Eg it adds "[NAME]__" to each new text.
" This should remove it from the mail body:
map #fix2 :/^$/,$s/\t\[.*\]\s\+//
"
" Part 4 - Weed Headers of quoted mail/post
"
" These mappings make use of the abbreviation that define a list of
" Email headers (HEMAIL) and News headers (HNEWS):
nmap ,we vip:v#HEMAIL#d
vmap ,we :v#HEMAIL#d
nmap ,wp vip:v#HNEWS#d
vmap ,wp :v#HNEWS#d
"
" ,ri = "Read in" basic lines from the email header
" Useful when replying to an email:
" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:"
" NOTE: "readmsg" ships with the mailer ELM.
"
"
" Part 5 - Reformatting Text
"
" NOTE: The following mapping require formatoptions to include 'r'
" and "comments" to include "n:>" (ie "nested" comments with '>').
"
" Formatting the current paragraph according to
" the current 'textwidth' with ^J (control-j):
" imap <C-J> <C-O>gqap " too dangerous for my editing ;-)
nmap <C-J> gqap
vmap <C-J> gq
"
" Here is a variation of this command. It inserts the character
" CTRL-Z at the current position to enable to rebound to the
" previous position within the text. [Hello, Y. K. Puckett!]
" map <C-J> i<C-Z><esc>gqip?<C-Z><cr>x
" imap <C-J> <C-Z><esc>gqip?<C-Z><cr>xi
"
" Some people prefer to use extrernal formatting utilities
" such as "fmt" or "par":
" nmap <C-J> !}fmt<cr>
" vmap <C-J> !fmt<cr>
"
"
" ,b = break line in commented text (to be used on a space)
" nmap ,b dwi<CR>> <ESC>
nmap ,b r<CR>
" ,j = join line in commented text
" (can be used anywhere on the line)
" nmap ,j Jxx
nmap ,j Vjgq
"
" ,B = break line at current position *and* join the next line
" nmap ,B i<CR>><ESC>Jxx
nmap ,B r<CR>Vjgq
"
" ,,, break current line at current column,
" inserting ellipsis and "filling space":
" nmap ,,, ,,1,,2
" nmap ,,1 a...X...<ESC>FXr<CR>lmaky$o<CC-R>"<ESC>
" nmap ,,2 :s/./ /g<C-M>3X0"yy$dd`a"yP
"
"
" ===================================================================
" Edit your reply! (Or else!)
" ===================================================================
"
" Part 6 - Inserting Special or Standard Text
" Part 6a - The header
" Add adresses for To: and Cc: lines
"
" ,ca = check alias (reads in expansion of alias name)
" map ,ca :r!elmalias -f "\%v (\%n)"
" ,Ca = check alias (reads in expansion of alias name)
" map ,Ca :r!elmalias -f "\%n <\%v>"
"
" ,cc = "copy notice"
" Insert a Cc line so that person will receive a "courtesy copy";
" this tells the addressee that text is a copy of a public article.
" This assumes that there is exactly one empty line after the first
" paragraph and the first line of the second paragraph contains the
" return address with a trailing colon (which is later removed).
map ,cc 1G}jyykPICc: <ESC>$x
" map ,cc ma1G}jy/ writes<CR>'aoCc: <ESC>$p
"
" ,mlu = make letter urgent (by giving the "Priority: urgent")
map ,mlu 1G}OPriority: urgent<ESC>
"
" Fixing the From: line
"
" ,cS = change Sven's address.
map ,cS 1G/^From: /e+1<CR>CSven Guckes <guckes@vim.org><ESC>
" Used when replying as the "guy from vim".
"
" Adjusting my Reply-To line [001010]
"
" Reply-To: guckes-usenet@math.fu-berlin.de
"
" ,cr = change Reply-TO line
map ,cr 1G/^Reply-To: guckes-usenet/e-5<CR>ct@
"
" Fixing the Subject line
"
" Pet peeve: Unmeaningful Subject lines. Change them!
" ,cs = change Subject: line
map ,cs 1G/^Subject: <CR>yypIX-Old-<ESC>-W
" This command keeps the old Subject line in "X-Old-Subject:" -
" so the recipient can still search for it and
" you keep a copy for editing.
"
" 001115:
" ,CS = Change Subject: line
map ,CS 1G/^Subject: <CR>:s/Re:/was:/<CR>Wi(<C-O>$)<ESC>0Wi
" This changes the "Re:" to "was:", puts everything into parentheses
" and then sets the cursor before the opening bracket for insertion
" of a new Subject line (which hopefully matches the contents better).
" Subject: Re: something
" Subject: X(was: something)
"
"
" ,re : Condense multiple "Re:_" to just one "Re:":
map ,re 1G/^Sub<CR>:s/\(Re: \)\+/Re: /<CR>
"
" ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines:
map ,Re 1G/^Subject: <C-M>:s/Re: Re\[\([0-9]\+\)\]/Re[\1]/<C-M><C-A>
"
" Put parentheses around "visual text"
" Used when commenting out an old subject.
" Example:
" Subject: help
" Subject: vim - using autoindent (Re: help)
"
" ,) and ,( :
vmap ,( v`<i(<ESC>`>a)<ESC>
vmap ,) v`<i(<ESC>`>a)<ESC>
"
" Part 6 - Inserting Special or Standard Text
" Part 6a - Start of text - saying "hello".
"
" ,hi = "Hi!" (indicates first reply)
map ,hi 1G}oHi!<CR><ESC>
"
" ,ha = "helloagain" (indicates reply to reply)
map ,ha 1G}oHello, again!<CR><ESC>
"
" ;HA = "Hallo, <NAME>!" (German equivalent of "hi!" for replies)
" map ;HA G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
" map ;HA G/^\* /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
map ;; G/^\* /e+1<CR>ye1G}oHallo, <c-r>"!<cr><ESC>
"
" ,He = "Hello, <NAME>!"
" map ,He G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>
map ,He G/^\* /e+1<CR>ye1G}oHello, !<ESC>Po<ESC>
"
" Part 6 - Inserting Special or Standard Text
" Part 6b - End of text - dealing with "signatures".
"
" remove signatures
"
" ,kqs = kill quoted sig (to remove those damn sigs for replies)
" goto end-of-buffer, search-backwards for a quoted sigdashes
" line, ie "^> -- $", and delete unto end-of-paragraph:
map ,kqs G?^> -- $<CR>d}
" map ,kqs G?^> *-- $<CR>dG
" ,kqs = kill quoted sig unto start of own signature:
" map ,kqs G?^> *-- $<CR>d/^-- $/<C-M>
"
" ===================================
" Adding quotes and signatures easily
" ===================================
"
" QUOTES: http://www.math.fu-berlin.de/~guckes/quotes/collection
" let QUOTES=expand("~/.P/quotes/collection")
"
" Decide which quote file to use:
" if filereadable("~/.P/quotes/collection")
" let QUOTES=expand("~/.P/quotes/collection")
" else
" use a copy in the homedir:
" let QUOTES=expand("~/.quotes")
" endif
"
" ,aq = "add quote"
" Reads in a quote from my favourite quotations:
nmap ,aq :r!agrep -d "^-- $" '' ~/.
P/quotes/collection<S-Left><S-Left><right>
" nmap ,aq :exe ":r!agrep -d '^-- $' ".QUOTES<S-Left>
"
" SIGNATURES: http://www.math.fu-berlin.de/~guckes/sig/SIGS
"
" let SIGS=expand("~/.P/sig/SIGS")
" if !filereadable(SIGS)
" use a copy in the homedir:
" let SIGS=expand("~/.signatures")
" endif
"
" ,s = "sign" -
" Read in signature file (requires manual completion):
" nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS<S-Left>
" nmap ,s :exe ":r!agrep -d '^-- $' ".SIGS<S-Left>
" nmap ,s :exe ":r!agrep -d '^-- $' '' ".SIGS<S-Left><S-Left><right>
nmap ,s :r!agrep -d "^-- $" '' ~/.P/sig/SIGS<S-Left><S-Left><right>
"
" SEE ALSO:
" Sven's page on sigs: http://www.math.fu-berlin.de/~guckes/sig/
" Sven's page on agrep: http://www.math.fu-berlin.de/~guckes/agrep/
"
" ,at = "add text" -
" read in text file (requires manual completion):
nmap ,at :r ~/.P/txt/
"
" MUTT: Auto-kill signatures for replies
" map ,kqs G?^> *-- $<C-M>dG
" autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs
"
" At the end of editing your reply you should check your spelling
" with the spelling checker "ispell".
" These mappings are from Lawrence Clapp lclapp@iname.com:
" spellcheck the document -- skip quoted text
" nmap <F5> :w ! grep -v '^>' \| spell<CR>
" vmap <F5> :w ! grep -v '^>' \| spell<CR>
" At home under Linux it looks something more like this:
" nmap <F5> :w ! grep -v '^>' \| ispell -???<CR>
"
" Tell the recipient that I was replying to an old email of his:
ab SvenR Sven [finally takeing the time to reply to old emails]
"
" Toggles: [todo]
"
" toggle autoindent
" toggle hlsearch
" cycle textwidth between values 60, 70, 75, 80
"
" ===================================================================
" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX
" ===================================================================
" This has become quite big - so I moved it out to another file:
" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim
" let FILE="/home/robinson/emailer/guckes/.P/vim/source/latex.vim"
" if filereadable(FILE)
" let RESULT="file readable"
" exe "source " . FILE
" else
" let RESULT="file not readable"
" endif
"
" ===================================================================
" PGP - encryption and decryption
" ===================================================================
"
" encrypt
map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty'
" decrypt
map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty'
" sign
map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
map ;v :,/^-----END/w !pgp -m
"
" PGP - original mappings
"
" encrypt and sign (useful for mailing to someone else)
"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4'
" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4
"
" sign (useful for mailing to someone else)
"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty'
" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty
"
" decrypt
"csh: map #3 :/^-----BEG/,/^-----END/!\
" /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4'
" sh: map #3 :/^-----BEG/,/^-----END/!\
" pgp -f 2>/dev/tty^V|^V|sleep 4
"
" view (pages output, like more)
"csh: map #4 :,/^-----END/w !pgp -m
" sh: map #4 :,/^-----END/w !pgp -m
"
" encrypt alone (useful for encrypting for oneself)
"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4'
" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4
"
" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says :
" The significant feature is that stderr is redirected independently
" of stdout, and it is redirected to /dev/tty which is a synonym for
" the current terminal on Unix. I don't know why the ||sleep 4
" stuff is there, but it is harmless so I left it. Since csh is such
" junk, special rules are used if you are using it (tcsh, too).
" ksh and bash should use the sh form. zsh, et al: consult your
" manual. The #<num> format is used to map function keys. If your
" terminal does not support the requested function key, use a
" literal #<num>. Not all of the clones correctly support this.
"
" ===================================================================
" Useful stuff. At least these are nice examples. :-)
" ===================================================================
"
" ,t = "transpose" - aXb -> bXa
" This exchanges the characters 'a' and 'b'
" which are next to the current position on 'X':
" map ,t XpxphXp
" map ,t xphXpxp
"
" #b = "browse" - send selected URL to Netscape
"vmap #b y:!netscape -remote "openurl <C-R>""
"vmap #b y:!netscape -remote 'openFile(<c-r>")' \|\| netscape <c-r>" &
"vmap #b y:!netscape -remote 'openFile(%:p)' || netscape file:%:p &
"
"
" make space move the cursor to the right - much better than a *beep*
" nmap \ l
"
" ,E = execute line
" map ,E 0/\$<CR>w"yy$:<C-R>y<C-A>r!<C-E>
" This command excutes a shell command from the current line and
" reads in its output into the buffer. It assumes that the command
" starts with the fist word after the first '$' (the shell prompt
" of /bin/sh). Try ",E" on that line, ie place the cursor on it
" and then press ",E":
" $ ls -la
" Note: The command line commands have been remapped to tcsh style!!
"
" ROT13 rot13
" ,dr = decode/encode rot13 text
" vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m
" Use this with an external "rot13" script:
" " ,13 - rot13 the visual text
" vmap ,13 :!rot13<CR>
" NOTE: Vim now has ROT13 built-in - see ":help g?".
" see also: http://www.math.fu-berlin.de/~guckes/rot13/
"
" Give the URL under the cursor to Netscape
" map ,net yA:!netscape -remote "openurl <C-R>""
"
"
" ===================================================================
" Mapping of special keys - arrow keys and function keys.
" ===================================================================
" Buffer commands (split,move,delete) -
" this makes a little more easy to deal with buffers.
" (works for Linux PCs in room 030)
" map <F4> :split<C-M>
" map <F5> :bp<C-M>
" map <F6> :bn<C-M>
" map <F12> :bd<C-M>
"
" Buffer commands (split,move,delete) -
" for Mac keyboard (Performa 5200, US keyboard)
"
" map <ESC>[19~ :split<C-M>
" map <ESC>[20~ :bp<C-M>
" map <ESC>[23~ :bn<C-M>
" map <ESC>[31~ :bd<C-M>
"
" Obvious mappings
"
" map <PageUp> <C-B>
" map <PageDown> <C-F>
"
" ===================================================================
" FAQ: Emacs editing"
" Q: How can I stay in insert mode and move around like within Emacs?
" A: Get the following file and source it like it is done here:
" URL: http://www.math.fu-berlin.de/~guckes/vim/source/emacs.vim
" let FILE="/home/robinson/emailer/guckes/.P/vim/source/emacs.vim"
" if filereadable(FILE)
" let RESULT="file readable"
" exe "source " . FILE
" else
" let RESULT="file not readable"
" endif
"
" Make the up and down movements move by "display/screen lines":
" map j gj
" map <Down> gj
" map k gk
" map <Up> gk
"
" Normal mode - tcsh style movements [960425]
"
" nmap <C-A> 0
" nmap <C-B> h
" nmap <C-D> x
" nmap <C-E> $
" nmap <C-F> l
" nmap <ESC>b b
" nmap <ESC>f w
"
" DOS keyboard mapping for cursor keys
"
" map <ESC>[A <Up>
" map <ESC>[B <Down>
" map <ESC>[C <Right>
" map <ESC>[D <Left>
" imap <ESC>[A <Up>
" imap <ESC>[B <Down>
" imap <ESC>[C <Right>
" imap <ESC>[D <Left>
"
" DOS keyboard
" "insert"
" map <ESC>[1~ i
" map <ESC>[1~ <insert>
" "home"
" map <ESC>[2~ ^
" map <ESC>[2~ 0
" map <ESC>[2~ <Home>
" "pgup"
" map <ESC>[3~ <C-B>
" map <ESC>[3~ <PageUp>
" "delete"
" map <ESC>[4~ x
" map <ESC>[4~ <Del>
" "end"
" map <ESC>[5~ $
" map <ESC>[5~ <END>
" "pgdn"
" map <ESC>[6~ <C-F>
" map <ESC>[6~ <PageDown>
"
" Keyboard mapping for cursor keys
" [works for SUNs in Solarium (room 030) - 970815]
"
map <ESC>OA <Up>
map <ESC>OB <Down>
map <ESC>OC <Right>
map <ESC>OD <Left>
imap <ESC>OA <Up>
imap <ESC>OB <Down>
imap <ESC>OC <Right>
imap <ESC>OD <Left>
"
" Keyboard mapping for cursor keys
" [works for XTerminals - 970818]
map <ESC>[A <Up>
map <ESC>[B <Down>
map <ESC>[C <Right>
map <ESC>[D <Left>
imap <ESC>[A <Up>
imap <ESC>[B <Down>
imap <ESC>[C <Right>
imap <ESC>[D <Left>
"
" 000810:
" Keyboard mapping for numeric keypad:
" imap <esc>ON ???
imap <esc>OM <c-m>
map <esc>OM <c-m>
imap <esc>OP <nop>
map <esc>OP <nop>
imap <esc>OQ /
map <esc>OQ /
imap <esc>OR *
map <esc>OR *
imap <esc>OS -
map <esc>OS -
"
imap <esc>Ol +
imap <esc>Om -
imap <esc>On ,
imap <esc>Op 0
imap <esc>Oq 1
imap <esc>Or 2
imap <esc>Os 3
imap <esc>Ot 4
imap <esc>Ou 5
imap <esc>Ov 6
imap <esc>Ow 7
imap <esc>Ox 8
imap <esc>Oy 9
imap <esc>Oz 0
"
"
" ===================================================================
" AutoCommands
" ===================================================================
"
" Autocommands are the key to "syntax coloring".
" There's one command in your vimrc that should
" load/source the file $VIM/syntax/syntax.vim
" which contains the definition for colors and
" the autocommands that load other syntax files
" when necessary, ie when the filename matches
" a given pattern, eg "*.c" or *".html".
"
" just load the main syntax file when Vim was compiled with "+syntax"
if has("syntax")
" The following sources the main syntax file,
" ie. "$VIM/syntax/syntax.vim", see ":help :syn-on":
syntax on
" Redefine the color for "Comment":
" hi! Comment term=bold ctermfg=cyan ctermbg=black guifg=blue guibg=black
" hi! Comment ctermfg=blue ctermbg=black guifg=blue guibg=black
hi! Comment term=NONE cterm=NONE
hi! Comment ctermfg=cyan ctermbg=black guifg=blue guibg=black
"
" The standard background color for the GUI Vim is "blue".
" No, I don't know why. But many users want to change this
" color to black so they can read the blue colored text. ;-)
" Here's how:
" hi normal ctermbg=black guibg=black
"
" Adjustments for editing messages:
" if version>=508
" the following file contains commands
" which simply change a few colors:
" au Syntax mail source ~guckes/.vim.mail.vim
" endif
endif
"
" Definition of an alternative syntax file:
" if has("syntax")
" " Define the filename patterns for mail and news:
" " MAILNEWSFILES... (missing, damn)
" " Define the aucommand tow work on special files:
" let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
" " execute the source command:
" exe aucommand." source ~guckes/.P/vim/syntax/sven.vim"
" "
" endif
"
"
" EXAMPLE: Restricting mappings to some files only:
" An autocommand does the macthing on the filenames -
" but abbreviations are not expanded within autocommands.
" Workaround: Use "exe" for expansion:
" let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES
" exe aucommand." :map ,hi 1G}oHi!<CR><ESC>"
" exe aucommand." :map ,ha 1G}oHello, again!<CR><ESC>"
" exe aucommand." :map ,H G/Quoting /e+1<CR>ye1G}oHallo, !<ESC>Po<ESC>"
" exe aucommand." :map ,re 1G}oRe!<CR><ESC>"
"
" Automatically place the cursor onto the first line of the mail body:
" autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j
"
" Toggle syntax coloring on/off with "__":
" nn __ mg:if has("syntax_items")<Bar>syn clear<CR>else<Bar>syn on<CR>en<CR>`g
" Note: It works - but the screen flashes are quite annoying. :-/
"
map <esc><esc> :if exists("syntax_on")\| syntax off\| else\| syntax on\|
endif
"
" ===================================================================
" EXAMPLES
" ===================================================================
"
" 020121: Adding stars/brackets/inverted commas around selected text:
" vmap #* <esc>`>a*<esc>`<i*<esc>gv
" vmap #( <esc>`>a)<esc>`<i(<esc>gv
vmap #* c**<left><c-r>"<esc>
vmap #( c()<left><c-r>"<esc>
"
" Visualizing trailing whitespace:
" :set hls
" /\s\+$
"
" Toggling a numerical variable between two values.
" Example: Switch the textwidth (tw) between values "70" and "80":
" map \1 :let &tw = 150 - &tw<CR>
"
" Capitalizing the previously typed word,
" returning to the previous position:
" imap CAP <ESC>mzB~`za
"
" Uppercasing the previously typed word,
" returning to the previous position:
" imap CAP <ESC>mzvBU`za
" imap CAP <ESC>mzBvaWU`za
"
" ===================================================================
" TEMPORARY STUFF - TESTING THINGS
" ===================================================================
"
" 020110:
" reformat current paragraph up to current
" column position as the textwidth:
nmap ## :let tw2=&tw<cr>:let &tw=col(".")<cr>gqip:let &tw=tw2<cr>
" hint: use the mappings for F5 and F6 to narrow/widen the text.
"
" 020107: reversing a selected block of text
" provided that either "rev" or "tac"
" has been installed on your system:
" vmap ## :!rev<CR>
" vmap ## :!tac<CR>
"
" 020105:
" reversing the lines within the current text selection:
" vmap ## :g/^/m'<<cr>
" vmap ## :g/^/co '<<cr>gvd
"
" 001201: Deleting text in normal mode
" using the BackSpace and Delete keys:
nmap <BS> X
nmap <DEL> x
"
" 001107
" Use "bc" to evaluate the arithmetic expression on the current line
" with a precision of '6' digits after the comma.
" It is assumed that the current line contains only the expression.
" The rsult is read in after the current line.
map #BC ^y$:r!echo 'scale=6; <c-r>"'\|bc<cr>
"
" 001010
" Add all numbers in the current visual selection.
vmap ,add !awk '{total += $1 ; print} ; END {print total}'
"
" Example:
" Remove comments from lines, select them with 'V'
" then type ",add" and <CR> to execute "awk":
" 123
" 456
" -789
" The result should be "210".
"
"
" Narrow/Widen current paragraph by
" adjusting the current textwidth
" and using internal formatting:
map <F5> :set tw-=2<cr>gqip
map <esc>[[E :set tw-=2<cr>gqip
vmap <F5> <esc>:set tw-=2<cr>gvgqgv
vmap <esc>[[E <esc>:set tw-=2<cr>gvgqgv
vmap ( <esc>:set tw-=2<cr>gvgqgv
map <F6> :set tw+=2<cr>gqip
vmap <F6> <esc>:set tw+=2<cr>gvgqgv
vmap ) <esc>:set tw+=2<cr>gvgqgv
"
" 001107: Use an explicit width for reformatting (here: 72):
" map <c-j> :let foo=&tw<cr>:se tw=72<cr>gqip:set tw=&foo<cr>
"
" screenshot from webpage shown with "links"
" contains escape codes which need deleting.
vmap p :s#<c-v><esc>([0B]##g
"
" View a html document (or part of it) with lynx. You need
" a system that supports the /def/fd/* file descriptors :-(
" nmap ,ly :w !lynx -force_html /dev/fd/0<CR>
" vmap ,ly :w !lynx -force_html /dev/fd/0<CR>
"
" Make Vim jump back one word in normal mode with <Left>,
" when it produces the code "<Esc>OD":
" nmap <Esc>OD b
"
" Some simple example of the "expand modifiers":
" insert the current filename *with* path:
iab YPATHFILE <C-R>=expand("%:p")<cr>
" insert the current filename *without* path:
iab YFILE <C-R>=expand("%:t:r")<cr>
" insert the path of current file:
iab YPATH <C-R>=expand("%:h")<cr>
iab YDIR <C-R>=expand("%:p:h")<cr>
" For more help see ":help filename-modifiers".
"
" Toggle highlight search and report the current value:
" map #1 :set hls!<cr>
" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3)<cr>
" map ## #1#2
"
" Sorting current line containing a list of numbers
" map ## :s/ /<C-M>/g<CR>vip!sort -n
"
" Replying to the mutt mailing list:
" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning
" map ,MM 1G/^Cc:<CR>2dd}o[mutt]<CR>
"
" map ,U %s#<URL:\(.*\)>#<a href="/1"></a>#gc
" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"<C-V><C-V>|\
" sed -f ~/.P/elm/scripts/weedout.sed
" map ,mb ebi<CR><b><ESC>Ea</b><CR><ESC>dw
"
" stripping netscape bookmarks and making them list items
" vmap ,ns :.,$s/^ *<DT><\(A.*"\) ADD.*">\(.*\)$/<li> <\1><C-M><C-I>\2/
"
" Jump to the last space before the 80th column.
" map ,\| 80\|F<space>
"
" extracting variable names from mutt's init.c
" :%s/^.*"\([a-z0-9_]*\)".*$/\1/
"
" \<> = change to <> notation by substituting ^M and ^[
" cab \<> s/<C-V><ESC>/<ESC>/gc<C-M>:s/<C-V><C-M>/<C-M>/gc<C-M>
"
" Changing the From_ line in pseudo mail folders to an appropriate
" value - so you can read them with a mailer.
" %s/^From /From guckes Thu Apr 6 12:07:00 1967/
"
" ===================================================================
" ASCII tables - you may need them some day. Save them to a file!
" ===================================================================
"
" 001005: In need of an ASII table? Perl is your friend:
" perl -e 'while($i++<256) { print chr($i); }'
"
" ASCII Table - | octal value - name/char |
"
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si |
" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb|
" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us |
" |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' |
" |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / |
" |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 |
" |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? |
" |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G |
" |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O |
" |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W |
" |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ |
" |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g |
" |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o |
" |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w |
" |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del|
"
" ===================================================================
" ASCII Table - | decimal value - name/char |
"
" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel|
" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si |
" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb|
" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us |
" |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' |
" |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / |
" |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 |
" |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? |
" |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G |
" |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O |
" |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W |
" |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ |
" |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g |
" |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o |
" |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w |
" |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del|
"
" ===================================================================
" ASCII Table - | hex value - name/char |
"
" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel|
" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si |
" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb|
" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us |
" | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' |
" | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / |
" | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 |
" | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? |
" | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G |
" | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O |
" | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W |
" | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ |
" | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g |
" | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o |
" | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w |
" | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del|
" ===================================================================
" Yet another example for an autocommand: [980616]
au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!"
" ===================================================================
" Last but not least...
" =====================================================
" The last line is allowed to be a "modeline" with my setup.
" It gives vim commands for setting variable values that are
" specific for editing this file. Used mostly for setting
" the textwidth (tw) and the "shiftwidth" (sw).
" Note that the colon within the value of "comments" needs to
" be escaped with a backslash! (Thanks, Thomas!)
" vim:tw=70 et sw=4 comments=\:\"
--
____________________________________________
|┏━━━━━━━━━━━━━━━━━━━━┓
|┃ 欢迎光临荔园晨风 Linux 版,InstallBBS 版┃
|┗━━━━━━━━━━━━━━━━━━━━┛
﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋﹋
※ 来源:·荔园晨风BBS站 bbs.szu.edu.cn·[FROM: 192.168.0.146]
[回到开始]
[上一篇][下一篇]
荔园在线首页 友情链接：深圳大学 深大招生 荔园晨风BBS S-Term软件 网络书店